Product Description
Recombinant Human Activin-B Protein [Insect cells] | 100-330S/100-330 | ReliaTech
Species: Human
Host / biotech: Insect cells
Comment: N/A
Label: N/A
Clone / Antibody feature: N/A
Subcategory: Cytokines & Growth Factors
Category: Recombinant Protein
Synonyms: INHBB, Inhibin beta-2, Activin beta-B
Isotype: N/A
Application: N/A
Detection Range: The ED50 as determined by its ability to inhibit the proliferation of murine MPC-11 cells is ≤ 2.0 ng/ml, corresponding to a specific activity of ≥ 5 x 105 units/mg.
Species Reactivity/Cross reactivity: Human
Antigen: N/A
Description: Activin B is a TGF-β family member that exhibits a wide range of biological activities including regulation of embryogenesis, osteogenesis, hematopoiesis, reproductive physiology and hormone secretion from the hypothalamic, pituitary and gonadal glands. Activin B, like certain other members of the TGF-β family, signals through the ActRII receptor (Activin Receptor type II). Human Activin B is a 25.6 kDa disulfide-linked homodimer consisting of two βB chains, each containing 115 amino acid residues.
Purity Confirmation: > 95% by SDS-PAGE & HPLC analyses
Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
Formulation: lyophilized
Storage Handling Stability: N/A
Reconstituation: N/A
Molecular Weight: 25.6 kDa
Lenght (aa): 115
Protein Sequence: GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
NCBI Gene ID: 3625