Product Description
Recombinant Human Amphiregulin (98aa) Protein [E. coli] | 100-393S/100-393 | ReliaTech
Species: Human
Host / biotech: E. coli
Comment: N/A
Label: N/A
Clone / Antibody feature: N/A
Subcategory: Cytokines & Growth Factors
Category: Recombinant Protein
Synonyms: AREG; AR; SDGF; AREGB; CRDGF
Isotype: N/A
Application: N/A
Detection Range: Determined by its ability to stimulate the proliferation of mouse Balb/c 3T3 cells. The expected ED50 for this effect is 5-10 ng/ml.
Species Reactivity/Cross reactivity: Human
Antigen: N/A
Description: Amphiregulin is an EGF related growth factor that signals through the EGF/TGF-a receptor, and stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein. There are 6 conserved cysteine residues, which form 3 intramolecular disulfide bonds essential for biological activity. Recombinant human Amphiregulin is a 11.3 kDa glycoprotein consisting of 98 amino acid residues.
Purity Confirmation: > 97% by SDS-PAGE & HPLC analyses
Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
Formulation: lyophilized
Storage Handling Stability: N/A
Reconstituation: N/A
Molecular Weight: 11.3 kDa
Lenght (aa): 98
Protein Sequence: SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
NCBI Gene ID: 374