Product Description
Recombinant Human Angiopoietin-like protein 3 Protein [CHO cells] | 100-402S/100-402 | ReliaTech
Species: Human
Host / biotech: CHO cells
Comment: N/A
Label: His-Tag
Clone / Antibody feature: N/A
Subcategory: Cytokines & Growth Factors
Category: Recombinant Protein
Synonyms: ANGPTL-3, ANG-5, ANGPT5
Isotype: N/A
Application: N/A
Detection Range: Measured by its binding ability to recombinant αvβ3 integrin in a functional ELISA.
Species Reactivity/Cross reactivity: Human
Antigen: N/A
Description: ANGPTL-3 (Angiopoietin like protein 3) is a member of the angiopoietin family of structurally related proteins, characterized by a coiled N-terminal domain and a C-terminal fibrinogen like domain. It is primarily expressed in the liver and can exert activities related to both angiogenesis and lipid metabolism. ANGPTL-3 inhibits lipoprotein lipase (LPL) and endothelial lipase (EL), which has the effect of increasing plasma levels of triglycerides and HDL associated cholesterol. The fibrinogen like portion of the ANGPTL-3 protein can bind alpha-5/beta-3 integrins leading to endothelial cell adhesion and migration. Recombinant human ANGPTL-3 is a glycoprotein that migrates by SDS-PAGE analysis at an apparent molecular weight of 62 kDa, and contains 452 amino acid residues including a C-terminal His tag.
Purity Confirmation: > 97% by SDS-PAGE & HPLC analyses
Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
Formulation: lyophilized
Storage Handling Stability: N/A
Reconstituation: N/A
Molecular Weight: 62 kDa
Lenght (aa): 452
Protein Sequence: SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEHHHHHHHH
NCBI Gene ID: 27329