Product Description
Recombinant Human IP-10 (CXCL10) Protein [E. coli] | 100-057S/100-057 | ReliaTech
Species: Human
Host / biotech: E. coli
Comment: N/A
Label: N/A
Clone / Antibody feature: N/A
Subcategory: Cytokines & Growth Factors
Category: Recombinant Protein
Synonyms: CXCL10
Isotype: N/A
Application: N/A
Detection Range: Determined by its ability to chemoattract human T-Lymphocytes using a concentration of 10-50 ng/ml.
Species Reactivity/Cross reactivity: Monkey, Mouse, Leech, Human
Antigen: N/A
Description: IP-10 is a CXC chemokine that signals through the CXCR3 receptor. IP-10 selectively chemoattracts Th1 lymphocytes and monocytes, and inhibits cytokine-stimulated hematopoietic progenitor cell proliferation. Additionally, it is angiostatic and mitogenic for vascular smooth muscle cells. Recombinant human IP-10 is an 8.6 kDa protein consisting of 77 amino acids including the four conserved cysteine residues present in CXC chemokines.
Purity Confirmation: > 98% by SDS-PAGE & HPLC analyses
Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
Formulation: lyophilized
Storage Handling Stability: N/A
Reconstituation: N/A
Molecular Weight: 8.6 kDa
Lenght (aa): 77
Protein Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
NCBI Gene ID: 3627