Product Description
Recombinant Human R-Spondin-1 Protein [CHO cells] | 100-130S/100-130 | ReliaTech
Species: Human
Host / biotech: CHO cells
Comment: N/A
Label: N/A
Clone / Antibody feature: N/A
Subcategory: Cytokines & Growth Factors
Category: Recombinant Protein
Synonyms: Roof plate-specific Spondin, Rspo1
Isotype: N/A
Application: N/A
Detection Range: R-spondin-1 enhances BMP-2 mediated differentiation of MC3T3-E1 cells. The expected ED50 is 1.0-3.0 ug/ml.
Species Reactivity/Cross reactivity: Human
Antigen: N/A
Description: R-Spondin-1 (Rspo-1) belongs to the (Rspo) family of Wnt modulators. Currently, the family consists of four structurally related secreted ligands (Rspo 1-4), all containing furin-like and thrombospondin structural domains. Rspo-1 is expressed in certain areas of the developing central nervous system, as well as in adrenal glands, ovary, testis, thyroid, and trachea. Rspo can interact with the Frizzled/LRP6 receptor complex in a manner that stimulates the Wnt/beta-catenin signaling pathway. Recombinant human R-Spondin-1 is a 26.7 kDa protein consisting of 243 amino acid residues. Due to glycosylation, R-Spondin-1 migrates at an apparent molecular weight of approximately 40.0 kDa by SDS PAGE analysis under reducing conditions.
Purity Confirmation: > 95% by SDS-PAGE & HPLC analyses
Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
Formulation: lyophilized
Storage Handling Stability: N/A
Reconstituation: N/A
Molecular Weight: 26.7 kDa
Lenght (aa): 243
Protein Sequence: SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
NCBI Gene ID: 284654