Euro
USD
British Pound
NULL
![Recombinant Human CD34, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/1280x1280/products/670676/928519/logo__42078.1651665136__94851.1651684060.jpg?c=2 "Recombinant Human CD34, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human CD34, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/100x100/products/670676/928519/logo__42078.1651665136__94851.1651684060.jpg?c=2 "Recombinant Human CD34, soluble Protein [E. coli]"){kind=logo}
Product Description
Recombinant Human CD34, soluble Protein [E. coli] | S01-069S/S01-069 | ReliaTech
Species: Human
Host / biotech: E. coli
Comment: N/A
Label: His-Tag
Clone / Antibody feature: N/A
Subcategory: Soluble Receptors
Category: Recombinant Protein
Synonyms: CD34
Isotype: N/A
Application: N/A
Detection Range: Data not available.
Species Reactivity/Cross reactivity: Human
Antigen: N/A
Description: CD34 is a highly glycosylated type I membrane protein that is selectively expressed on hematopoietic stem cells and vascular endothelium. It has been widely used as a molecular marker for the identification, isolation, and manipulation of hemopoietic stem cells and progenitors. CD34 can function as a regulator of hemopoietic cell adhesion by mediating the attachment of stem cells to bone marrow stromal cells or other bone marrow components. The full length human CD34 is a 385 amino acid protein, consisting of a 31 amino acid signal sequence, a 74 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain and a 259 amino acid extracellular domain. Recombinant human sCD34 is a 258 amino acid polypeptide containing only the extracellular domain of the full length CD34 protein.
Purity Confirmation: > 95% by SDS-PAGE
Endotoxin: N/A
Formulation: lyophilized
Storage Handling Stability: N/A
Reconstituation: N/A
Molecular Weight: 28.6 kDa
Lenght (aa): 267
Protein Sequence: SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLEHHHHHH
NCBI Gene ID: 947
![Recombinant Human CD34, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/670676/928519/logo__42078.1651665136__94851.1651684060.jpg?c=2 "Recombinant Human CD34, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human CD23, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/670656/928499/logo__42078.1651665136__73378.1651684053.jpg?c=2 "Recombinant Human CD23, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human TWEAK receptor, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/672207/930050/logo__42078.1651665136__41777.1651684501.jpg?c=2 "Recombinant Human TWEAK receptor, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human Ephrin-B2, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/670929/928772/logo__42078.1651665136__40831.1651684122.jpg?c=2 "Recombinant Human Ephrin-B2, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human BAFF receptor, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/670490/928333/logo__42078.1651665136__82922.1651683813.jpg?c=2 "Recombinant Human BAFF receptor, soluble Protein [E. coli]"){kind=logo}
![Recombinant Human Podoplanin, soluble Protein [E. coli]](https://cdn11.bigcommerce.com/s-452hpg8iuh/images/stencil/500x659/products/671882/929725/logo__42078.1651665136__72782.1651684408.jpg?c=2 "Recombinant Human Podoplanin, soluble Protein [E. coli]"){kind=logo}