Product Description
Recombinant Human Endomucin Protein [E. coli] | S01-064 | ReliaTech
Species: Human
Host / biotech: E. coli
Comment: N/A
Label: His-Tag
Clone / Antibody feature: N/A
Subcategory: Soluble Receptors
Category: Recombinant Protein
Synonyms: Endomucin-2, Gastric cancer antigen Ga34, Mucin-14
Isotype: N/A
Application: N/A
Detection Range: Data not available.
Species Reactivity/Cross reactivity: Human
Antigen: N/A
Description: Endomucin (endothelial sialomucin; also Endomucin-1/2 and Mucin-14) is an 80 - 120 kDa glycoprotein member of the Endomucin family of proteins. It is expressed on endothelial cells and depending upon its glycosylation pattern, can serve as either a pro- or anti-adhesive molecule. Mouse Endomucin precursor is 261 amino acids in length. It is type I transmembrane protein that contains a 170 aa extracellular domain (ECD) (aa 21 - 190) and a 50 aa cytoplasmic region. Three splice variants exist in the ECD. One shows a deletion of aa 91 - 141, a second shows a one aa substitution for aa 91 - 129, and a third shows a one aa substitution for aa 129 - 142. Over aa 21 - 90, mouse Endomucin shares 60% and 30% aa identity with rat and human Endomucin, respectively.
Purity Confirmation: > 95% by SDS-PAGE
Endotoxin: N/A
Formulation: lyophilized
Storage Handling Stability: The material is stable for greater than six months at -20° C to -70° C. After the first thawing it is recommended to aliquote the material, because repeated freeze-thaw cycles will decrease the activity.
Reconstituation: The lyophilized human soluble Endomucin is soluble in water and most aqueous buffers; it should be reconstituted in water or PBS to a concentration of not lower than 100 µg/ml.
Molecular Weight: 20.4 kDa
Lenght (aa): 197
Protein Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSS
NCBI Gene ID: 51705