Product Description
C-C chemokine receptor type 6 (CCR6) is the receptor for the CCL20 chemokine as well as beta-defensins. CCR6 is responsible for the chemotaxis of dendritic cells as well as B and T lymphocytes, inflammation and immune responses, and wound healing. CCR6 has been associated with Crohn's disease, and is also implicated in tumor progression due to recruitment of macrophages and other immune cells to the tumor microenvironment, particularly in gastrointestinal malignancies such as colorectal cancer.
Biovision | A2299 | CCR6 Antibody DataSheet
Antibody Target: Human CCR6
Target Alternative Name: CCR6; BN-1; C-C CKR-6; CC-CKR-6; CCR-6; CD196; CKR-L3; CKRL3; CMKBR6; DCR2; DRY6; GPR29; GPRCY4; STRL22
Tag Line: An important mediator of immune cell differentiation and inflammatory responses
Category: GM-CSF
Host: Rabbit
Isotype: Rabbit IgG
Species Reactivities: Human
Immunogen Sequence: VTEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQTSETADNDNASSFTM
Accession #: P51684
Gene ID: 1235
Appearance: Liquid
Form: Rabbit polyclonal
Concentration:
Formulation: In PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
Purification: Affinity purified
Application: Western Blotting
Positive Control:
Application And Usages:
Country of Animal Origin: USA
Country of Manufacture: USA
Usage: For Research Use Only! Not to be used in humans.
Handling: The antibody solution should be gently mixed before use.
Western Blot Verified: TRUE
Immunocytochemistry Verified:
Immunofluorescence Verified: FALSE
Immunoprecipitation Verified: FALSE
FACS Verified:
ELISA Verified: FALSE
ChIP Verified: FALSE
Dot Blot Verified: FALSE
Flow Cytometry Verified: FALSE