Euro
USD
British Pound
NULL
Product Description
Tumor necrosis factor receptor superfamily member 5 (TNFRSF5) is also known as CD40, is a member of the TNF receptor superfamily. The expression of CD40 is diverse. TNFRSF5 has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is the receptor for TNFSF5/CD40LG. Defects in CD40 are the cause of immunodeficiency with hyper-IgM type 3 (HIGM3).
Biovision | 9230 | Human CellExp Human CD40/ TNFRSF5 Human recombinant DataSheet
Biomolecule/Target: CD40
Synonyms: CD40, Bp50, CDW40, MGC9013, TNFRSF5, p50
Alternates names: Glia maturation factor gamma, GMF-gamma, GMFG, MGC126867
Taglines: Tumor necrosis factor receptor superfamily member 5
NCBI Gene ID #: 9535
NCBI Gene Symbol: GMFG
Gene Source: Human
Accession #: O60234
Recombinant: Yes
Source: E. coli
Purity by SDS-PAGEs: 90%
Assay: SDS-PAGE
Purity: >95%
Assay #2: N/A
Endotoxin Level: < 1 EU/g
Activity (Specifications/test method): Measured by its binding ability in a functional ELISA.
Biological activity: N/A
Results: N/A
Binding Capacity: Immobilized Human CD40, His Tag at 1 µg/mL (100 µL/well) can bind Human CD40 Ligand /TNFSF5 with a linear range of 0.01-0.12 ng/mL.
Unit Definition: N/A
Molecular Weight: 16.8 kDa
Concentration: N/A
Appearance: Lyophilized
Physical form description: Lyophilized from 0.22 m filtered solution in PBS, pH 7.4. Normally Mannitol or Trehalose is added as protectants before lyophilization.
Reconstitution Instructions: N/A
Amino acid sequence: MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR
